Anti GAS7 pAb (ATL-HPA064678)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064678-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GAS7
Alternative Gene Name: KIAA0394, MGC1348
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033066: 98%, ENSRNOG00000049361: 98%
Entrez Gene ID: 8522
Uniprot ID: O60861
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIKLSNKTEEDIKKGRRKS |
Gene Sequence | SAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIKLSNKTEEDIKKGRRKS |
Gene ID - Mouse | ENSMUSG00000033066 |
Gene ID - Rat | ENSRNOG00000049361 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GAS7 pAb (ATL-HPA064678) | |
Datasheet | Anti GAS7 pAb (ATL-HPA064678) Datasheet (External Link) |
Vendor Page | Anti GAS7 pAb (ATL-HPA064678) at Atlas Antibodies |
Documents & Links for Anti GAS7 pAb (ATL-HPA064678) | |
Datasheet | Anti GAS7 pAb (ATL-HPA064678) Datasheet (External Link) |
Vendor Page | Anti GAS7 pAb (ATL-HPA064678) |