Anti GAS7 pAb (ATL-HPA064678)

Atlas Antibodies

Catalog No.:
ATL-HPA064678-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: growth arrest-specific 7
Gene Name: GAS7
Alternative Gene Name: KIAA0394, MGC1348
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033066: 98%, ENSRNOG00000049361: 98%
Entrez Gene ID: 8522
Uniprot ID: O60861
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIKLSNKTEEDIKKGRRKS
Gene Sequence SAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIKLSNKTEEDIKKGRRKS
Gene ID - Mouse ENSMUSG00000033066
Gene ID - Rat ENSRNOG00000049361
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAS7 pAb (ATL-HPA064678)
Datasheet Anti GAS7 pAb (ATL-HPA064678) Datasheet (External Link)
Vendor Page Anti GAS7 pAb (ATL-HPA064678) at Atlas Antibodies

Documents & Links for Anti GAS7 pAb (ATL-HPA064678)
Datasheet Anti GAS7 pAb (ATL-HPA064678) Datasheet (External Link)
Vendor Page Anti GAS7 pAb (ATL-HPA064678)