Anti GAS6 pAb (ATL-HPA008275)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008275-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GAS6
Alternative Gene Name: AXLLG, AXSF, DKFZp666G247, FLJ34709
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031451: 76%, ENSRNOG00000018233: 79%
Entrez Gene ID: 2621
Uniprot ID: Q14393
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | STWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTS |
Gene Sequence | STWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTS |
Gene ID - Mouse | ENSMUSG00000031451 |
Gene ID - Rat | ENSRNOG00000018233 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GAS6 pAb (ATL-HPA008275) | |
Datasheet | Anti GAS6 pAb (ATL-HPA008275) Datasheet (External Link) |
Vendor Page | Anti GAS6 pAb (ATL-HPA008275) at Atlas Antibodies |
Documents & Links for Anti GAS6 pAb (ATL-HPA008275) | |
Datasheet | Anti GAS6 pAb (ATL-HPA008275) Datasheet (External Link) |
Vendor Page | Anti GAS6 pAb (ATL-HPA008275) |
Citations for Anti GAS6 pAb (ATL-HPA008275) – 3 Found |
Tirado-Gonzalez, Irene; Descot, Arnaud; Soetopo, Devona; Nevmerzhitskaya, Aleksandra; Schäffer, Alexander; Kur, Ivan-Maximilano; Czlonka, Ewelina; Wachtel, Carolin; Tsoukala, Ioanna; Müller, Luise; Schäfer, Anna-Lena; Weitmann, Maresa; Dinse, Petra; Alberto, Emily; Buck, Michèle C; Landry, Jonathan Jm; Baying, Bianka; Slotta-Huspenina, Julia; Roesler, Jenny; Harter, Patrick N; Kubasch, Anne-Sophie; Meinel, Jörn; Elwakeel, Eiman; Strack, Elisabeth; Quang, Christine Tran; Abdel-Wahab, Omar; Schmitz, Marc; Weigert, Andreas; Schmid, Tobias; Platzbecker, Uwe; Benes, Vladimir; Ghysdael, Jacques; Bonig, Halvard; Götze, Katharina S; Rothlin, Carla V; Ghosh, Sourav; Medyouf, Hind. AXL Inhibition in Macrophages Stimulates Host-versus-Leukemia Immunity and Eradicates Naïve and Treatment-Resistant Leukemia. Cancer Discovery. 2021;11(11):2924-2943. PubMed |
Pinato, D J; Mauri, F A; Lloyd, T; Vaira, V; Casadio, C; Boldorini, R L; Sharma, R. The expression of Axl receptor tyrosine kinase influences the tumour phenotype and clinical outcome of patients with malignant pleural mesothelioma. British Journal Of Cancer. 2013;108(3):621-8. PubMed |
Pinato, David J; Brown, Matthew W; Trousil, Sebastian; Aboagye, Eric O; Beaumont, Jamie; Zhang, Hua; Coley, Helen M; Mauri, Francesco A; Sharma, Rohini. Integrated analysis of multiple receptor tyrosine kinases identifies Axl as a therapeutic target and mediator of resistance to sorafenib in hepatocellular carcinoma. British Journal Of Cancer. 2019;120(5):512-521. PubMed |