Anti GAS2 pAb (ATL-HPA058904 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA058904-25
  • Immunohistochemistry analysis in human liver and pancreas tissues using Anti-GAS2 antibody. Corresponding GAS2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: growth arrest-specific 2
Gene Name: GAS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030498: 96%, ENSRNOG00000016717: 96%
Entrez Gene ID: 2620
Uniprot ID: O43903
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYLVVSASYKAKKEI
Gene Sequence FAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYLVVSASYKAKKEI
Gene ID - Mouse ENSMUSG00000030498
Gene ID - Rat ENSRNOG00000016717
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GAS2 pAb (ATL-HPA058904 w/enhanced validation)
Datasheet Anti GAS2 pAb (ATL-HPA058904 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GAS2 pAb (ATL-HPA058904 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GAS2 pAb (ATL-HPA058904 w/enhanced validation)
Datasheet Anti GAS2 pAb (ATL-HPA058904 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GAS2 pAb (ATL-HPA058904 w/enhanced validation)