Anti GAS1 pAb (ATL-HPA066902)

Atlas Antibodies

Catalog No.:
ATL-HPA066902-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: growth arrest-specific 1
Gene Name: GAS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052957: 89%, ENSRNOG00000050485: 89%
Entrez Gene ID: 2619
Uniprot ID: P54826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVIEDMLAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDG
Gene Sequence TVIEDMLAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDG
Gene ID - Mouse ENSMUSG00000052957
Gene ID - Rat ENSRNOG00000050485
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAS1 pAb (ATL-HPA066902)
Datasheet Anti GAS1 pAb (ATL-HPA066902) Datasheet (External Link)
Vendor Page Anti GAS1 pAb (ATL-HPA066902) at Atlas Antibodies

Documents & Links for Anti GAS1 pAb (ATL-HPA066902)
Datasheet Anti GAS1 pAb (ATL-HPA066902) Datasheet (External Link)
Vendor Page Anti GAS1 pAb (ATL-HPA066902)