Anti GAS1 pAb (ATL-HPA066902)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066902-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GAS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052957: 89%, ENSRNOG00000050485: 89%
Entrez Gene ID: 2619
Uniprot ID: P54826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TVIEDMLAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDG |
| Gene Sequence | TVIEDMLAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDG |
| Gene ID - Mouse | ENSMUSG00000052957 |
| Gene ID - Rat | ENSRNOG00000050485 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GAS1 pAb (ATL-HPA066902) | |
| Datasheet | Anti GAS1 pAb (ATL-HPA066902) Datasheet (External Link) |
| Vendor Page | Anti GAS1 pAb (ATL-HPA066902) at Atlas Antibodies |
| Documents & Links for Anti GAS1 pAb (ATL-HPA066902) | |
| Datasheet | Anti GAS1 pAb (ATL-HPA066902) Datasheet (External Link) |
| Vendor Page | Anti GAS1 pAb (ATL-HPA066902) |