Anti GART pAb (ATL-HPA005779)

Atlas Antibodies

Catalog No.:
ATL-HPA005779-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase
Gene Name: GART
Alternative Gene Name: PGFT, PRGS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022962: 78%, ENSRNOG00000028292: 82%
Entrez Gene ID: 2618
Uniprot ID: P22102
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGDLLLTPTRIYSHSLLPVLRSGHVKAFAHITGGGLLENIPRVLPEKLGVDLDAQTWRIPRVFSWLQQEGHLSEEEMARTFNCGVGAVLVVSKEQTEQILRDIQQHKEEAWVIGSVVARAEGSPRVKVKNLIESMQINGSVLKNGSLT
Gene Sequence LGDLLLTPTRIYSHSLLPVLRSGHVKAFAHITGGGLLENIPRVLPEKLGVDLDAQTWRIPRVFSWLQQEGHLSEEEMARTFNCGVGAVLVVSKEQTEQILRDIQQHKEEAWVIGSVVARAEGSPRVKVKNLIESMQINGSVLKNGSLT
Gene ID - Mouse ENSMUSG00000022962
Gene ID - Rat ENSRNOG00000028292
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GART pAb (ATL-HPA005779)
Datasheet Anti GART pAb (ATL-HPA005779) Datasheet (External Link)
Vendor Page Anti GART pAb (ATL-HPA005779) at Atlas Antibodies

Documents & Links for Anti GART pAb (ATL-HPA005779)
Datasheet Anti GART pAb (ATL-HPA005779) Datasheet (External Link)
Vendor Page Anti GART pAb (ATL-HPA005779)