Anti GAREM2 pAb (ATL-HPA071575)

Atlas Antibodies

SKU: ATL-HPA071575-25

• 

Protein Description: GRB2 associated regulator of MAPK1 subtype 2
Gene Name: GAREM2
Alternative Gene Name: FAM59B, FLJ00375, GAREML, KIAA2038
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044576: 99%, ENSRNOG00000048004: 99%
Entrez Gene ID: 150946
Uniprot ID: Q75VX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REGHCYKLVSIISKTVVLGLALRREGPAPLHFLLLTDTPRFALPQGLLAGDPRVERLVRDSASYCRERFDPDEY
• Gene Sequence: REGHCYKLVSIISKTVVLGLALRREGPAPLHFLLLTDTPRFALPQGLLAGDPRVERLVRDSASYCRERFDPDEY
• Gene ID - Mouse: ENSMUSG00000044576
• Gene ID - Rat: ENSRNOG00000048004
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.