Anti GAR1 pAb (ATL-HPA059098)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059098-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GAR1
Alternative Gene Name: NOLA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028010: 95%, ENSRNOG00000061146: 95%
Entrez Gene ID: 54433
Uniprot ID: Q9NY12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT |
Gene Sequence | GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT |
Gene ID - Mouse | ENSMUSG00000028010 |
Gene ID - Rat | ENSRNOG00000061146 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GAR1 pAb (ATL-HPA059098) | |
Datasheet | Anti GAR1 pAb (ATL-HPA059098) Datasheet (External Link) |
Vendor Page | Anti GAR1 pAb (ATL-HPA059098) at Atlas Antibodies |
Documents & Links for Anti GAR1 pAb (ATL-HPA059098) | |
Datasheet | Anti GAR1 pAb (ATL-HPA059098) Datasheet (External Link) |
Vendor Page | Anti GAR1 pAb (ATL-HPA059098) |