Anti GAR1 pAb (ATL-HPA059098)

Atlas Antibodies

Catalog No.:
ATL-HPA059098-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GAR1 ribonucleoprotein
Gene Name: GAR1
Alternative Gene Name: NOLA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028010: 95%, ENSRNOG00000061146: 95%
Entrez Gene ID: 54433
Uniprot ID: Q9NY12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT
Gene Sequence GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT
Gene ID - Mouse ENSMUSG00000028010
Gene ID - Rat ENSRNOG00000061146
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAR1 pAb (ATL-HPA059098)
Datasheet Anti GAR1 pAb (ATL-HPA059098) Datasheet (External Link)
Vendor Page Anti GAR1 pAb (ATL-HPA059098) at Atlas Antibodies

Documents & Links for Anti GAR1 pAb (ATL-HPA059098)
Datasheet Anti GAR1 pAb (ATL-HPA059098) Datasheet (External Link)
Vendor Page Anti GAR1 pAb (ATL-HPA059098)