Anti GAR1 pAb (ATL-HPA059098)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059098-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GAR1
Alternative Gene Name: NOLA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028010: 95%, ENSRNOG00000061146: 95%
Entrez Gene ID: 54433
Uniprot ID: Q9NY12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT |
| Gene Sequence | GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT |
| Gene ID - Mouse | ENSMUSG00000028010 |
| Gene ID - Rat | ENSRNOG00000061146 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GAR1 pAb (ATL-HPA059098) | |
| Datasheet | Anti GAR1 pAb (ATL-HPA059098) Datasheet (External Link) |
| Vendor Page | Anti GAR1 pAb (ATL-HPA059098) at Atlas Antibodies |
| Documents & Links for Anti GAR1 pAb (ATL-HPA059098) | |
| Datasheet | Anti GAR1 pAb (ATL-HPA059098) Datasheet (External Link) |
| Vendor Page | Anti GAR1 pAb (ATL-HPA059098) |