Anti GANC pAb (ATL-HPA016949)

Atlas Antibodies

Catalog No.:
ATL-HPA016949-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glucosidase, alpha; neutral C
Gene Name: GANC
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062646: 81%, ENSRNOG00000024563: 81%
Entrez Gene ID: 2595
Uniprot ID: Q8TET4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASQPVMRPLWVEFPDELKTFDMEDEYMLGSALLVHPVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCTVKIPVALDTIPVFQRGGSVIPIKTTVGKSTGWMTESSYGLRVALSTKGSSVGELYLDDGHSFQYLHQKQ
Gene Sequence ASQPVMRPLWVEFPDELKTFDMEDEYMLGSALLVHPVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCTVKIPVALDTIPVFQRGGSVIPIKTTVGKSTGWMTESSYGLRVALSTKGSSVGELYLDDGHSFQYLHQKQ
Gene ID - Mouse ENSMUSG00000062646
Gene ID - Rat ENSRNOG00000024563
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GANC pAb (ATL-HPA016949)
Datasheet Anti GANC pAb (ATL-HPA016949) Datasheet (External Link)
Vendor Page Anti GANC pAb (ATL-HPA016949) at Atlas Antibodies

Documents & Links for Anti GANC pAb (ATL-HPA016949)
Datasheet Anti GANC pAb (ATL-HPA016949) Datasheet (External Link)
Vendor Page Anti GANC pAb (ATL-HPA016949)