Anti GANAB pAb (ATL-HPA026874 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA026874-25
  • Immunohistochemistry analysis in human thyroid gland and skeletal muscle tissues using Anti-GANAB antibody. Corresponding GANAB RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glucosidase, alpha; neutral AB
Gene Name: GANAB
Alternative Gene Name: G2AN, GluII, KIAA0088
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071650: 87%, ENSRNOG00000019724: 85%
Entrez Gene ID: 23193
Uniprot ID: Q14697
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALGQRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQ
Gene Sequence AYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALGQRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQ
Gene ID - Mouse ENSMUSG00000071650
Gene ID - Rat ENSRNOG00000019724
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GANAB pAb (ATL-HPA026874 w/enhanced validation)
Datasheet Anti GANAB pAb (ATL-HPA026874 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GANAB pAb (ATL-HPA026874 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GANAB pAb (ATL-HPA026874 w/enhanced validation)
Datasheet Anti GANAB pAb (ATL-HPA026874 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GANAB pAb (ATL-HPA026874 w/enhanced validation)



Citations for Anti GANAB pAb (ATL-HPA026874 w/enhanced validation) – 1 Found
Ju, Mingyi; Qi, Aoshuang; Bi, Jia; Zhao, Lan; Jiang, Longyang; Zhang, Qiang; Wei, Qian; Guan, Qiutong; Li, Xueping; Wang, Lin; Wei, Minjie; Zhao, Lin. A five-mRNA signature associated with post-translational modifications can better predict recurrence and survival in cervical cancer. Journal Of Cellular And Molecular Medicine. 2020;24(11):6283-6297.  PubMed