Anti GAMT pAb (ATL-HPA051806)

Atlas Antibodies

Catalog No.:
ATL-HPA051806-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: guanidinoacetate N-methyltransferase
Gene Name: GAMT
Alternative Gene Name: PIG2, TP53I2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020150: 94%, ENSRNOG00000024577: 94%
Entrez Gene ID: 2593
Uniprot ID: Q14353
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVP
Gene Sequence DGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVP
Gene ID - Mouse ENSMUSG00000020150
Gene ID - Rat ENSRNOG00000024577
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAMT pAb (ATL-HPA051806)
Datasheet Anti GAMT pAb (ATL-HPA051806) Datasheet (External Link)
Vendor Page Anti GAMT pAb (ATL-HPA051806) at Atlas Antibodies

Documents & Links for Anti GAMT pAb (ATL-HPA051806)
Datasheet Anti GAMT pAb (ATL-HPA051806) Datasheet (External Link)
Vendor Page Anti GAMT pAb (ATL-HPA051806)