Anti GAMT pAb (ATL-HPA051806)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051806-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: GAMT
Alternative Gene Name: PIG2, TP53I2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020150: 94%, ENSRNOG00000024577: 94%
Entrez Gene ID: 2593
Uniprot ID: Q14353
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVP |
Gene Sequence | DGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVP |
Gene ID - Mouse | ENSMUSG00000020150 |
Gene ID - Rat | ENSRNOG00000024577 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GAMT pAb (ATL-HPA051806) | |
Datasheet | Anti GAMT pAb (ATL-HPA051806) Datasheet (External Link) |
Vendor Page | Anti GAMT pAb (ATL-HPA051806) at Atlas Antibodies |
Documents & Links for Anti GAMT pAb (ATL-HPA051806) | |
Datasheet | Anti GAMT pAb (ATL-HPA051806) Datasheet (External Link) |
Vendor Page | Anti GAMT pAb (ATL-HPA051806) |