Anti GALR1 pAb (ATL-HPA074584)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074584-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GALR1
Alternative Gene Name: GALNR, GALNR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024553: 81%, ENSRNOG00000016654: 81%
Entrez Gene ID: 2587
Uniprot ID: P47211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVT |
| Gene Sequence | MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVT |
| Gene ID - Mouse | ENSMUSG00000024553 |
| Gene ID - Rat | ENSRNOG00000016654 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GALR1 pAb (ATL-HPA074584) | |
| Datasheet | Anti GALR1 pAb (ATL-HPA074584) Datasheet (External Link) |
| Vendor Page | Anti GALR1 pAb (ATL-HPA074584) at Atlas Antibodies |
| Documents & Links for Anti GALR1 pAb (ATL-HPA074584) | |
| Datasheet | Anti GALR1 pAb (ATL-HPA074584) Datasheet (External Link) |
| Vendor Page | Anti GALR1 pAb (ATL-HPA074584) |