Anti GALP pAb (ATL-HPA053938)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053938-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GALP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034660: 59%, ENSRNOG00000022129: 59%
Entrez Gene ID: 85569
Uniprot ID: Q9UBC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKE |
| Gene Sequence | GYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKE |
| Gene ID - Mouse | ENSMUSG00000034660 |
| Gene ID - Rat | ENSRNOG00000022129 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GALP pAb (ATL-HPA053938) | |
| Datasheet | Anti GALP pAb (ATL-HPA053938) Datasheet (External Link) |
| Vendor Page | Anti GALP pAb (ATL-HPA053938) at Atlas Antibodies |
| Documents & Links for Anti GALP pAb (ATL-HPA053938) | |
| Datasheet | Anti GALP pAb (ATL-HPA053938) Datasheet (External Link) |
| Vendor Page | Anti GALP pAb (ATL-HPA053938) |