Anti GALP pAb (ATL-HPA053938)

Atlas Antibodies

Catalog No.:
ATL-HPA053938-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: galanin-like peptide
Gene Name: GALP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034660: 59%, ENSRNOG00000022129: 59%
Entrez Gene ID: 85569
Uniprot ID: Q9UBC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKE
Gene Sequence GYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKE
Gene ID - Mouse ENSMUSG00000034660
Gene ID - Rat ENSRNOG00000022129
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GALP pAb (ATL-HPA053938)
Datasheet Anti GALP pAb (ATL-HPA053938) Datasheet (External Link)
Vendor Page Anti GALP pAb (ATL-HPA053938) at Atlas Antibodies

Documents & Links for Anti GALP pAb (ATL-HPA053938)
Datasheet Anti GALP pAb (ATL-HPA053938) Datasheet (External Link)
Vendor Page Anti GALP pAb (ATL-HPA053938)