Anti GALNT8 pAb (ATL-HPA073461)

Atlas Antibodies

Catalog No.:
ATL-HPA073461-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: polypeptide N-acetylgalactosaminyltransferase 8
Gene Name: GALNT8
Alternative Gene Name: GALNAC-T8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038296: 40%, ENSRNOG00000017021: 40%
Entrez Gene ID: 26290
Uniprot ID: Q9NY28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QMKLFPHSQLFRQWGEDLSEAQQKAAQDLFRKFGYNAYLSNQLPLNRTIPDTRDYRCLRKTYPSQLPSLSVI
Gene Sequence QMKLFPHSQLFRQWGEDLSEAQQKAAQDLFRKFGYNAYLSNQLPLNRTIPDTRDYRCLRKTYPSQLPSLSVI
Gene ID - Mouse ENSMUSG00000038296
Gene ID - Rat ENSRNOG00000017021
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GALNT8 pAb (ATL-HPA073461)
Datasheet Anti GALNT8 pAb (ATL-HPA073461) Datasheet (External Link)
Vendor Page Anti GALNT8 pAb (ATL-HPA073461) at Atlas Antibodies

Documents & Links for Anti GALNT8 pAb (ATL-HPA073461)
Datasheet Anti GALNT8 pAb (ATL-HPA073461) Datasheet (External Link)
Vendor Page Anti GALNT8 pAb (ATL-HPA073461)