Anti GALNT7 pAb (ATL-HPA065317 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA065317-25
  • Immunohistochemistry analysis in human stomach and liver tissues using HPA065317 antibody. Corresponding GALNT7 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line HeLa shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: polypeptide N-acetylgalactosaminyltransferase 7
Gene Name: GALNT7
Alternative Gene Name: GALNAC-T7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031608: 91%, ENSRNOG00000012037: 93%
Entrez Gene ID: 51809
Uniprot ID: Q86SF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDPSPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESIRRINKAKNEQEHHAGG
Gene Sequence DDPSPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESIRRINKAKNEQEHHAGG
Gene ID - Mouse ENSMUSG00000031608
Gene ID - Rat ENSRNOG00000012037
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GALNT7 pAb (ATL-HPA065317 w/enhanced validation)
Datasheet Anti GALNT7 pAb (ATL-HPA065317 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALNT7 pAb (ATL-HPA065317 w/enhanced validation)