Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA064243-25

Protein Description: polypeptide N-acetylgalactosaminyltransferase 7
Gene Name: GALNT7
Alternative Gene Name: GALNAC-T7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031608: 88%, ENSRNOG00000012037: 89%
Entrez Gene ID: 51809
Uniprot ID: Q86SF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKRAI
• Gene Sequence: GDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKRAI
• Gene ID - Mouse: ENSMUSG00000031608
• Gene ID - Rat: ENSRNOG00000012037
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.