Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064243-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GALNT7
Alternative Gene Name: GALNAC-T7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031608: 88%, ENSRNOG00000012037: 89%
Entrez Gene ID: 51809
Uniprot ID: Q86SF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKRAI |
| Gene Sequence | GDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKRAI |
| Gene ID - Mouse | ENSMUSG00000031608 |
| Gene ID - Rat | ENSRNOG00000012037 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation) | |
| Datasheet | Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation) | |
| Datasheet | Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation) |