Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA064243-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: polypeptide N-acetylgalactosaminyltransferase 7
Gene Name: GALNT7
Alternative Gene Name: GALNAC-T7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031608: 88%, ENSRNOG00000012037: 89%
Entrez Gene ID: 51809
Uniprot ID: Q86SF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKRAI
Gene Sequence GDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKRAI
Gene ID - Mouse ENSMUSG00000031608
Gene ID - Rat ENSRNOG00000012037
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation)
Datasheet Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation)
Datasheet Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALNT7 pAb (ATL-HPA064243 w/enhanced validation)