Anti GALNT5 pAb (ATL-HPA008963)

Atlas Antibodies

Catalog No.:
ATL-HPA008963-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: polypeptide N-acetylgalactosaminyltransferase 5
Gene Name: GALNT5
Alternative Gene Name: GalNAc-T5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026828: 56%, ENSRNOG00000004645: 53%
Entrez Gene ID: 11227
Uniprot ID: Q7Z7M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AERDLNVTISLSTDRPKQRSQAVANERAHPASTAVPKSGEAMALNKTKTQSKEVNANKHKANTSLPFPKFTVNSNRLRKQSINETPLGSLSKDDGARGAHGKKLNFSESHLVIITKEEEQKADPKEVSNSKTKTIFPKVLGKS
Gene Sequence AERDLNVTISLSTDRPKQRSQAVANERAHPASTAVPKSGEAMALNKTKTQSKEVNANKHKANTSLPFPKFTVNSNRLRKQSINETPLGSLSKDDGARGAHGKKLNFSESHLVIITKEEEQKADPKEVSNSKTKTIFPKVLGKS
Gene ID - Mouse ENSMUSG00000026828
Gene ID - Rat ENSRNOG00000004645
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GALNT5 pAb (ATL-HPA008963)
Datasheet Anti GALNT5 pAb (ATL-HPA008963) Datasheet (External Link)
Vendor Page Anti GALNT5 pAb (ATL-HPA008963) at Atlas Antibodies

Documents & Links for Anti GALNT5 pAb (ATL-HPA008963)
Datasheet Anti GALNT5 pAb (ATL-HPA008963) Datasheet (External Link)
Vendor Page Anti GALNT5 pAb (ATL-HPA008963)
Citations for Anti GALNT5 pAb (ATL-HPA008963) – 1 Found
Detarya, Marutpong; Lert-Itthiporn, Worachart; Mahalapbutr, Panupong; Klaewkla, Methus; Sorin, Supannika; Sawanyawisuth, Kanlayanee; Silsirivanit, Atit; Seubwai, Wunchana; Wongkham, Chaisiri; Araki, Norie; Wongkham, Sopit. Emerging roles of GALNT5 on promoting EGFR activation in cholangiocarcinoma: a mechanistic insight. American Journal Of Cancer Research. 12(9):4140-4159.  PubMed