Anti GALNT5 pAb (ATL-HPA008963)

Atlas Antibodies

SKU: ATL-HPA008963-25

• 
• 

Protein Description: polypeptide N-acetylgalactosaminyltransferase 5
Gene Name: GALNT5
Alternative Gene Name: GalNAc-T5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026828: 56%, ENSRNOG00000004645: 53%
Entrez Gene ID: 11227
Uniprot ID: Q7Z7M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AERDLNVTISLSTDRPKQRSQAVANERAHPASTAVPKSGEAMALNKTKTQSKEVNANKHKANTSLPFPKFTVNSNRLRKQSINETPLGSLSKDDGARGAHGKKLNFSESHLVIITKEEEQKADPKEVSNSKTKTIFPKVLGKS
• Gene Sequence: AERDLNVTISLSTDRPKQRSQAVANERAHPASTAVPKSGEAMALNKTKTQSKEVNANKHKANTSLPFPKFTVNSNRLRKQSINETPLGSLSKDDGARGAHGKKLNFSESHLVIITKEEEQKADPKEVSNSKTKTIFPKVLGKS
• Gene ID - Mouse: ENSMUSG00000026828
• Gene ID - Rat: ENSRNOG00000004645
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GALNT5 pAb (ATL-HPA008963) – 1 Found

Detarya, Marutpong; Lert-Itthiporn, Worachart; Mahalapbutr, Panupong; Klaewkla, Methus; Sorin, Supannika; Sawanyawisuth, Kanlayanee; Silsirivanit, Atit; Seubwai, Wunchana; Wongkham, Chaisiri; Araki, Norie; Wongkham, Sopit. Emerging roles of GALNT5 on promoting EGFR activation in cholangiocarcinoma: a mechanistic insight. American Journal Of Cancer Research. 12(9):4140-4159.