Anti GALNT4 pAb (ATL-HPA076116)

Atlas Antibodies

Catalog No.:
ATL-HPA076116-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: polypeptide N-acetylgalactosaminyltransferase 4
Gene Name: GALNT4
Alternative Gene Name: GalNAc-T4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090035: 86%, ENSRNOG00000019718: 38%
Entrez Gene ID: 8693
Uniprot ID: Q8N4A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWHFKEDGTIFHPHSGLCLSAYRTPEGRPDVQMRTCDA
Gene Sequence IRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWHFKEDGTIFHPHSGLCLSAYRTPEGRPDVQMRTCDA
Gene ID - Mouse ENSMUSG00000090035
Gene ID - Rat ENSRNOG00000019718
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GALNT4 pAb (ATL-HPA076116)
Datasheet Anti GALNT4 pAb (ATL-HPA076116) Datasheet (External Link)
Vendor Page Anti GALNT4 pAb (ATL-HPA076116) at Atlas Antibodies

Documents & Links for Anti GALNT4 pAb (ATL-HPA076116)
Datasheet Anti GALNT4 pAb (ATL-HPA076116) Datasheet (External Link)
Vendor Page Anti GALNT4 pAb (ATL-HPA076116)