Anti GALNT2 pAb (ATL-HPA011222 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011222-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GALNT2
Alternative Gene Name: GalNAc-T2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092329: 96%, ENSRNOG00000019143: 96%
Entrez Gene ID: 2590
Uniprot ID: Q10471
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNL |
| Gene Sequence | SCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNL |
| Gene ID - Mouse | ENSMUSG00000092329 |
| Gene ID - Rat | ENSRNOG00000019143 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GALNT2 pAb (ATL-HPA011222 w/enhanced validation) | |
| Datasheet | Anti GALNT2 pAb (ATL-HPA011222 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GALNT2 pAb (ATL-HPA011222 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GALNT2 pAb (ATL-HPA011222 w/enhanced validation) | |
| Datasheet | Anti GALNT2 pAb (ATL-HPA011222 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GALNT2 pAb (ATL-HPA011222 w/enhanced validation) |
| Citations for Anti GALNT2 pAb (ATL-HPA011222 w/enhanced validation) – 7 Found |
| Lorenz, Virginia; Ditamo, Yanina; Cejas, Romina B; Carrizo, Maria E; Bennett, Eric P; Clausen, Henrik; Nores, Gustavo A; Irazoqui, Fernando J. Extrinsic Functions of Lectin Domains in O-N-Acetylgalactosamine Glycan Biosynthesis. The Journal Of Biological Chemistry. 2016;291(49):25339-25350. PubMed |
| García, Iris A; Torres Demichelis, Vanina; Viale, Diego L; Di Giusto, Pablo; Ezhova, Yulia; Polishchuk, Roman S; Sampieri, Luciana; Martinez, Hernán; Sztul, Elizabeth; Alvarez, Cecilia. CREB3L1-mediated functional and structural adaptation of the secretory pathway in hormone-stimulated thyroid cells. Journal Of Cell Science. 2017;130(24):4155-4167. PubMed |
| Oguchi, Mai E; Okuyama, Koki; Homma, Yuta; Fukuda, Mitsunori. A comprehensive analysis of Rab GTPases reveals a role for Rab34 in serum starvation-induced primary ciliogenesis. The Journal Of Biological Chemistry. 2020;295(36):12674-12685. PubMed |
| Sampieri, Luciana; Funes Chabán, Macarena; Di Giusto, Pablo; Rozés-Salvador, Victoria; Alvarez, Cecilia. CREB3L2 Modulates Nerve Growth Factor-Induced Cell Differentiation. Frontiers In Molecular Neuroscience. 14( 34421533):650338. PubMed |
| Cejas, Romina B; Lorenz, Virginia; Garay, Yohana C; Irazoqui, Fernando J. Biosynthesis of O-N-acetylgalactosamine glycans in the human cell nucleus. The Journal Of Biological Chemistry. 2019;294(9):2997-3011. PubMed |
| Hobohm, Laura; Koudelka, Tomas; Bahr, Fenja H; Truberg, Jule; Kapell, Sebastian; Schacht, Sarah-Sophie; Meisinger, Daniel; Mengel, Marion; Jochimsen, Alexander; Hofmann, Anna; Heintz, Lukas; Tholey, Andreas; Voss, Matthias. N-terminome analyses underscore the prevalence of SPPL3-mediated intramembrane proteolysis among Golgi-resident enzymes and its role in Golgi enzyme secretion. Cellular And Molecular Life Sciences : Cmls. 2022;79(3):185. PubMed |
| Ruggiero, Fernando M; Martínez-Koteski, Natalia; Cavieres, Viviana A; Mardones, Gonzalo A; Fidelio, Gerardo D; Vilcaes, Aldo A; Daniotti, Jose L. Golgi Phosphoprotein 3 Regulates the Physical Association of Glycolipid Glycosyltransferases. International Journal Of Molecular Sciences. 2022;23(18) PubMed |