Anti GALNT16 pAb (ATL-HPA075325)

Atlas Antibodies

Catalog No.:
ATL-HPA075325-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: polypeptide N-acetylgalactosaminyltransferase 16
Gene Name: GALNT16
Alternative Gene Name: GalNAc-T16, GALNTL1, KIAA1130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021130: 95%, ENSRNOG00000004589: 96%
Entrez Gene ID: 57452
Uniprot ID: Q8N428
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRAGRRSEQLREDRTIPLIVTGTPSKGFDEKAYLSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPS
Gene Sequence QRAGRRSEQLREDRTIPLIVTGTPSKGFDEKAYLSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPS
Gene ID - Mouse ENSMUSG00000021130
Gene ID - Rat ENSRNOG00000004589
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GALNT16 pAb (ATL-HPA075325)
Datasheet Anti GALNT16 pAb (ATL-HPA075325) Datasheet (External Link)
Vendor Page Anti GALNT16 pAb (ATL-HPA075325) at Atlas Antibodies

Documents & Links for Anti GALNT16 pAb (ATL-HPA075325)
Datasheet Anti GALNT16 pAb (ATL-HPA075325) Datasheet (External Link)
Vendor Page Anti GALNT16 pAb (ATL-HPA075325)