Anti GALNS pAb (ATL-HPA074225)

Atlas Antibodies

Catalog No.:
ATL-HPA074225-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: galactosamine (N-acetyl)-6-sulfatase
Gene Name: GALNS
Alternative Gene Name: GALNAC6S, GAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015027: 82%, ENSRNOG00000014461: 83%
Entrez Gene ID: 2588
Uniprot ID: P34059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADNTFVFFTSDNGAALISAPEQGGSNGPFLCGKQT
Gene Sequence ALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADNTFVFFTSDNGAALISAPEQGGSNGPFLCGKQT
Gene ID - Mouse ENSMUSG00000015027
Gene ID - Rat ENSRNOG00000014461
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GALNS pAb (ATL-HPA074225)
Datasheet Anti GALNS pAb (ATL-HPA074225) Datasheet (External Link)
Vendor Page Anti GALNS pAb (ATL-HPA074225) at Atlas Antibodies

Documents & Links for Anti GALNS pAb (ATL-HPA074225)
Datasheet Anti GALNS pAb (ATL-HPA074225) Datasheet (External Link)
Vendor Page Anti GALNS pAb (ATL-HPA074225)