Anti GALM pAb (ATL-HPA064835 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA064835-25
  • Immunohistochemistry analysis in human kidney and skin tissues using Anti-GALM antibody. Corresponding GALM RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: galactose mutarotase
Gene Name: GALM
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035473: 84%, ENSRNOG00000007023: 91%
Entrez Gene ID: 130589
Uniprot ID: Q96C23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEG
Gene Sequence DVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEG
Gene ID - Mouse ENSMUSG00000035473
Gene ID - Rat ENSRNOG00000007023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GALM pAb (ATL-HPA064835 w/enhanced validation)
Datasheet Anti GALM pAb (ATL-HPA064835 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALM pAb (ATL-HPA064835 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GALM pAb (ATL-HPA064835 w/enhanced validation)
Datasheet Anti GALM pAb (ATL-HPA064835 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALM pAb (ATL-HPA064835 w/enhanced validation)