Anti GALK2 pAb (ATL-HPA048267)

Atlas Antibodies

Catalog No.:
ATL-HPA048267-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: galactokinase 2
Gene Name: GALK2
Alternative Gene Name: GK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027207: 94%, ENSRNOG00000009289: 97%
Entrez Gene ID: 2585
Uniprot ID: Q01415
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EICAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPLRATDVKLPSGAVFVIANSCVEMNKAATSHFNIRVMECRLAAKLLAKYK
Gene Sequence EICAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPLRATDVKLPSGAVFVIANSCVEMNKAATSHFNIRVMECRLAAKLLAKYK
Gene ID - Mouse ENSMUSG00000027207
Gene ID - Rat ENSRNOG00000009289
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GALK2 pAb (ATL-HPA048267)
Datasheet Anti GALK2 pAb (ATL-HPA048267) Datasheet (External Link)
Vendor Page Anti GALK2 pAb (ATL-HPA048267) at Atlas Antibodies

Documents & Links for Anti GALK2 pAb (ATL-HPA048267)
Datasheet Anti GALK2 pAb (ATL-HPA048267) Datasheet (External Link)
Vendor Page Anti GALK2 pAb (ATL-HPA048267)