Anti GAL3ST4 pAb (ATL-HPA038137)

Atlas Antibodies

Catalog No.:
ATL-HPA038137-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: galactose-3-O-sulfotransferase 4
Gene Name: GAL3ST4
Alternative Gene Name: FLJ12116
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075593: 76%, ENSRNOG00000001375: 76%
Entrez Gene ID: 79690
Uniprot ID: Q96RP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLADALCWGLDDVVGFMHNAQAGHKQGLSTVSNSGLTAEDRQLTARARAWNNLDWALYVHFNRSLWARIEKYGQGRLQTAVAE
Gene Sequence LLADALCWGLDDVVGFMHNAQAGHKQGLSTVSNSGLTAEDRQLTARARAWNNLDWALYVHFNRSLWARIEKYGQGRLQTAVAE
Gene ID - Mouse ENSMUSG00000075593
Gene ID - Rat ENSRNOG00000001375
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAL3ST4 pAb (ATL-HPA038137)
Datasheet Anti GAL3ST4 pAb (ATL-HPA038137) Datasheet (External Link)
Vendor Page Anti GAL3ST4 pAb (ATL-HPA038137) at Atlas Antibodies

Documents & Links for Anti GAL3ST4 pAb (ATL-HPA038137)
Datasheet Anti GAL3ST4 pAb (ATL-HPA038137) Datasheet (External Link)
Vendor Page Anti GAL3ST4 pAb (ATL-HPA038137)