Anti GAL3ST1 pAb (ATL-HPA077138)

Atlas Antibodies

Catalog No.:
ATL-HPA077138-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: galactose-3-O-sulfotransferase 1
Gene Name: GAL3ST1
Alternative Gene Name: CST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049721: 85%, ENSRNOG00000042041: 85%
Entrez Gene ID: 9514
Uniprot ID: Q99999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDSHLYRHFNASFWRKVEAFGRERMAREVAALRHANERMRTICIDGGHAVDAAAIQDEAMQPWQPLGTKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLM
Gene Sequence LDSHLYRHFNASFWRKVEAFGRERMAREVAALRHANERMRTICIDGGHAVDAAAIQDEAMQPWQPLGTKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLM
Gene ID - Mouse ENSMUSG00000049721
Gene ID - Rat ENSRNOG00000042041
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAL3ST1 pAb (ATL-HPA077138)
Datasheet Anti GAL3ST1 pAb (ATL-HPA077138) Datasheet (External Link)
Vendor Page Anti GAL3ST1 pAb (ATL-HPA077138) at Atlas Antibodies

Documents & Links for Anti GAL3ST1 pAb (ATL-HPA077138)
Datasheet Anti GAL3ST1 pAb (ATL-HPA077138) Datasheet (External Link)
Vendor Page Anti GAL3ST1 pAb (ATL-HPA077138)