Anti GAL3ST1 pAb (ATL-HPA001220)

Atlas Antibodies

Catalog No.:
ATL-HPA001220-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: galactose-3-O-sulfotransferase 1
Gene Name: GAL3ST1
Alternative Gene Name: CST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049721: 87%, ENSRNOG00000042041: 87%
Entrez Gene ID: 9514
Uniprot ID: Q99999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLNILFRFGQKHRLKFAFPNGRNDFDYPTFFARSLVQDYRPGACFNIICNHMRFHYDEVRGLVPTNAIFITVLRDPARLFESSFHYFGPVVPLTWKLSAGDKLTEFLQDPDRYYDPNGFNAHYLRNLLFFDLGYDNSLDPSSPQVQEHIL
Gene Sequence LLNILFRFGQKHRLKFAFPNGRNDFDYPTFFARSLVQDYRPGACFNIICNHMRFHYDEVRGLVPTNAIFITVLRDPARLFESSFHYFGPVVPLTWKLSAGDKLTEFLQDPDRYYDPNGFNAHYLRNLLFFDLGYDNSLDPSSPQVQEHIL
Gene ID - Mouse ENSMUSG00000049721
Gene ID - Rat ENSRNOG00000042041
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAL3ST1 pAb (ATL-HPA001220)
Datasheet Anti GAL3ST1 pAb (ATL-HPA001220) Datasheet (External Link)
Vendor Page Anti GAL3ST1 pAb (ATL-HPA001220) at Atlas Antibodies

Documents & Links for Anti GAL3ST1 pAb (ATL-HPA001220)
Datasheet Anti GAL3ST1 pAb (ATL-HPA001220) Datasheet (External Link)
Vendor Page Anti GAL3ST1 pAb (ATL-HPA001220)
Citations for Anti GAL3ST1 pAb (ATL-HPA001220) – 1 Found
Kiebish, Michael A; Young, Dee M; Lehman, John J; Han, Xianlin. Chronic caloric restriction attenuates a loss of sulfatide content in PGC-1α-/- mouse cortex: a potential lipidomic role of PGC-1α in neurodegeneration. Journal Of Lipid Research. 2012;53(2):273-81.  PubMed