Anti GAK pAb (ATL-HPA027463)

Atlas Antibodies

Catalog No.: ATL-HPA027463-25

Protein Description: cyclin G associated kinase
Gene Name: GAK
Alternative Gene Name: DNAJC26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062234: 98%, ENSRNOG00000000048: 98%
Entrez Gene ID: 2580
Uniprot ID: O14976
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVE
• Gene Sequence: VLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVE
• Gene ID - Mouse: ENSMUSG00000062234
• Gene ID - Rat: ENSRNOG00000000048
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GAK pAb (ATL-HPA027463) – 1 Found

Wolf, Benita; Busso, Coralie; Gönczy, Pierre. Live imaging screen reveals that TYRO3 and GAK ensure accurate spindle positioning in human cells. Nature Communications. 2019;10(1):2859.