Anti GAK pAb (ATL-HPA027463)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027463-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GAK
Alternative Gene Name: DNAJC26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062234: 98%, ENSRNOG00000000048: 98%
Entrez Gene ID: 2580
Uniprot ID: O14976
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVE |
Gene Sequence | VLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVE |
Gene ID - Mouse | ENSMUSG00000062234 |
Gene ID - Rat | ENSRNOG00000000048 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GAK pAb (ATL-HPA027463) | |
Datasheet | Anti GAK pAb (ATL-HPA027463) Datasheet (External Link) |
Vendor Page | Anti GAK pAb (ATL-HPA027463) at Atlas Antibodies |
Documents & Links for Anti GAK pAb (ATL-HPA027463) | |
Datasheet | Anti GAK pAb (ATL-HPA027463) Datasheet (External Link) |
Vendor Page | Anti GAK pAb (ATL-HPA027463) |
Citations for Anti GAK pAb (ATL-HPA027463) – 1 Found |
Wolf, Benita; Busso, Coralie; Gönczy, Pierre. Live imaging screen reveals that TYRO3 and GAK ensure accurate spindle positioning in human cells. Nature Communications. 2019;10(1):2859. PubMed |