Anti GAK pAb (ATL-HPA027463)

Atlas Antibodies

Catalog No.:
ATL-HPA027463-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cyclin G associated kinase
Gene Name: GAK
Alternative Gene Name: DNAJC26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062234: 98%, ENSRNOG00000000048: 98%
Entrez Gene ID: 2580
Uniprot ID: O14976
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVE
Gene Sequence VLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVE
Gene ID - Mouse ENSMUSG00000062234
Gene ID - Rat ENSRNOG00000000048
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAK pAb (ATL-HPA027463)
Datasheet Anti GAK pAb (ATL-HPA027463) Datasheet (External Link)
Vendor Page Anti GAK pAb (ATL-HPA027463) at Atlas Antibodies

Documents & Links for Anti GAK pAb (ATL-HPA027463)
Datasheet Anti GAK pAb (ATL-HPA027463) Datasheet (External Link)
Vendor Page Anti GAK pAb (ATL-HPA027463)
Citations for Anti GAK pAb (ATL-HPA027463) – 1 Found
Wolf, Benita; Busso, Coralie; Gönczy, Pierre. Live imaging screen reveals that TYRO3 and GAK ensure accurate spindle positioning in human cells. Nature Communications. 2019;10(1):2859.  PubMed