Anti GAK pAb (ATL-HPA027405)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027405-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GAK
Alternative Gene Name: DNAJC26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062234: 94%, ENSRNOG00000000048: 94%
Entrez Gene ID: 2580
Uniprot ID: O14976
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ITRNTTPMYRTPEIIDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFH |
Gene Sequence | ITRNTTPMYRTPEIIDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFH |
Gene ID - Mouse | ENSMUSG00000062234 |
Gene ID - Rat | ENSRNOG00000000048 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GAK pAb (ATL-HPA027405) | |
Datasheet | Anti GAK pAb (ATL-HPA027405) Datasheet (External Link) |
Vendor Page | Anti GAK pAb (ATL-HPA027405) at Atlas Antibodies |
Documents & Links for Anti GAK pAb (ATL-HPA027405) | |
Datasheet | Anti GAK pAb (ATL-HPA027405) Datasheet (External Link) |
Vendor Page | Anti GAK pAb (ATL-HPA027405) |