Anti GAK pAb (ATL-HPA027405)

Atlas Antibodies

Catalog No.:
ATL-HPA027405-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cyclin G associated kinase
Gene Name: GAK
Alternative Gene Name: DNAJC26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062234: 94%, ENSRNOG00000000048: 94%
Entrez Gene ID: 2580
Uniprot ID: O14976
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ITRNTTPMYRTPEIIDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFH
Gene Sequence ITRNTTPMYRTPEIIDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFH
Gene ID - Mouse ENSMUSG00000062234
Gene ID - Rat ENSRNOG00000000048
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAK pAb (ATL-HPA027405)
Datasheet Anti GAK pAb (ATL-HPA027405) Datasheet (External Link)
Vendor Page Anti GAK pAb (ATL-HPA027405) at Atlas Antibodies

Documents & Links for Anti GAK pAb (ATL-HPA027405)
Datasheet Anti GAK pAb (ATL-HPA027405) Datasheet (External Link)
Vendor Page Anti GAK pAb (ATL-HPA027405)