Anti GADL1 pAb (ATL-HPA040229)

Atlas Antibodies

Catalog No.:
ATL-HPA040229-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glutamate decarboxylase-like 1
Gene Name: GADL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056880: 89%, ENSRNOG00000011573: 58%
Entrez Gene ID: 339896
Uniprot ID: Q6ZQY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGAAPFLVC
Gene Sequence CHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGAAPFLVC
Gene ID - Mouse ENSMUSG00000056880
Gene ID - Rat ENSRNOG00000011573
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GADL1 pAb (ATL-HPA040229)
Datasheet Anti GADL1 pAb (ATL-HPA040229) Datasheet (External Link)
Vendor Page Anti GADL1 pAb (ATL-HPA040229) at Atlas Antibodies

Documents & Links for Anti GADL1 pAb (ATL-HPA040229)
Datasheet Anti GADL1 pAb (ATL-HPA040229) Datasheet (External Link)
Vendor Page Anti GADL1 pAb (ATL-HPA040229)