Anti GADD45GIP1 pAb (ATL-HPA065048)

Atlas Antibodies

Catalog No.:
ATL-HPA065048-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: growth arrest and DNA-damage-inducible, gamma interacting protein 1
Gene Name: GADD45GIP1
Alternative Gene Name: CKBBP2, CKbetaBP2, CRIF1, MGC4667, MGC4758, PLINP-1, Plinp1, PRG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033751: 74%, ENSRNOG00000003011: 79%
Entrez Gene ID: 90480
Uniprot ID: Q8TAE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER
Gene Sequence ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER
Gene ID - Mouse ENSMUSG00000033751
Gene ID - Rat ENSRNOG00000003011
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GADD45GIP1 pAb (ATL-HPA065048)
Datasheet Anti GADD45GIP1 pAb (ATL-HPA065048) Datasheet (External Link)
Vendor Page Anti GADD45GIP1 pAb (ATL-HPA065048) at Atlas Antibodies

Documents & Links for Anti GADD45GIP1 pAb (ATL-HPA065048)
Datasheet Anti GADD45GIP1 pAb (ATL-HPA065048) Datasheet (External Link)
Vendor Page Anti GADD45GIP1 pAb (ATL-HPA065048)