Anti GADD45A pAb (ATL-HPA053420)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053420-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GADD45A
Alternative Gene Name: DDIT1, GADD45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036390: 91%, ENSRNOG00000005615: 88%
Entrez Gene ID: 1647
Uniprot ID: P24522
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQ |
| Gene Sequence | MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQ |
| Gene ID - Mouse | ENSMUSG00000036390 |
| Gene ID - Rat | ENSRNOG00000005615 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GADD45A pAb (ATL-HPA053420) | |
| Datasheet | Anti GADD45A pAb (ATL-HPA053420) Datasheet (External Link) |
| Vendor Page | Anti GADD45A pAb (ATL-HPA053420) at Atlas Antibodies |
| Documents & Links for Anti GADD45A pAb (ATL-HPA053420) | |
| Datasheet | Anti GADD45A pAb (ATL-HPA053420) Datasheet (External Link) |
| Vendor Page | Anti GADD45A pAb (ATL-HPA053420) |
| Citations for Anti GADD45A pAb (ATL-HPA053420) – 1 Found |
| Zhao, Liang; Cheng, Zhe; Lu, Zhiyue; Jin, Jianqiu. NAD-dependent methylenetetrahydrofolate dehydrogenase inhibits oral squamous cell carcinoma cell proliferation and promotes apoptosis. Translational Cancer Research. 2021;10(3):1457-1469. PubMed |