Anti GADD45A pAb (ATL-HPA053420)

Atlas Antibodies

Catalog No.:
ATL-HPA053420-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: growth arrest and DNA-damage-inducible, alpha
Gene Name: GADD45A
Alternative Gene Name: DDIT1, GADD45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036390: 91%, ENSRNOG00000005615: 88%
Entrez Gene ID: 1647
Uniprot ID: P24522
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQ
Gene Sequence MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQ
Gene ID - Mouse ENSMUSG00000036390
Gene ID - Rat ENSRNOG00000005615
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GADD45A pAb (ATL-HPA053420)
Datasheet Anti GADD45A pAb (ATL-HPA053420) Datasheet (External Link)
Vendor Page Anti GADD45A pAb (ATL-HPA053420) at Atlas Antibodies

Documents & Links for Anti GADD45A pAb (ATL-HPA053420)
Datasheet Anti GADD45A pAb (ATL-HPA053420) Datasheet (External Link)
Vendor Page Anti GADD45A pAb (ATL-HPA053420)
Citations for Anti GADD45A pAb (ATL-HPA053420) – 1 Found
Zhao, Liang; Cheng, Zhe; Lu, Zhiyue; Jin, Jianqiu. NAD-dependent methylenetetrahydrofolate dehydrogenase inhibits oral squamous cell carcinoma cell proliferation and promotes apoptosis. Translational Cancer Research. 2021;10(3):1457-1469.  PubMed