Anti GABRG3 pAb (ATL-HPA054010)

Atlas Antibodies

Catalog No.: ATL-HPA054010-25

Protein Description: gamma-aminobutyric acid (GABA) A receptor, gamma 3
Gene Name: GABRG3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055026: 93%, ENSRNOG00000014862: 91%
Entrez Gene ID: 2567
Uniprot ID: Q99928
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYD
• Gene Sequence: ARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYD
• Gene ID - Mouse: ENSMUSG00000055026
• Gene ID - Rat: ENSRNOG00000014862
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.