Anti GABRG3 pAb (ATL-HPA054010)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054010-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GABRG3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055026: 93%, ENSRNOG00000014862: 91%
Entrez Gene ID: 2567
Uniprot ID: Q99928
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYD |
Gene Sequence | ARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYD |
Gene ID - Mouse | ENSMUSG00000055026 |
Gene ID - Rat | ENSRNOG00000014862 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GABRG3 pAb (ATL-HPA054010) | |
Datasheet | Anti GABRG3 pAb (ATL-HPA054010) Datasheet (External Link) |
Vendor Page | Anti GABRG3 pAb (ATL-HPA054010) at Atlas Antibodies |
Documents & Links for Anti GABRG3 pAb (ATL-HPA054010) | |
Datasheet | Anti GABRG3 pAb (ATL-HPA054010) Datasheet (External Link) |
Vendor Page | Anti GABRG3 pAb (ATL-HPA054010) |