Anti GABRG3 pAb (ATL-HPA054010)

Atlas Antibodies

Catalog No.:
ATL-HPA054010-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: gamma-aminobutyric acid (GABA) A receptor, gamma 3
Gene Name: GABRG3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055026: 93%, ENSRNOG00000014862: 91%
Entrez Gene ID: 2567
Uniprot ID: Q99928
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYD
Gene Sequence ARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYD
Gene ID - Mouse ENSMUSG00000055026
Gene ID - Rat ENSRNOG00000014862
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GABRG3 pAb (ATL-HPA054010)
Datasheet Anti GABRG3 pAb (ATL-HPA054010) Datasheet (External Link)
Vendor Page Anti GABRG3 pAb (ATL-HPA054010) at Atlas Antibodies

Documents & Links for Anti GABRG3 pAb (ATL-HPA054010)
Datasheet Anti GABRG3 pAb (ATL-HPA054010) Datasheet (External Link)
Vendor Page Anti GABRG3 pAb (ATL-HPA054010)