Anti GABRG1 pAb (ATL-HPA058102)

Atlas Antibodies

Catalog No.:
ATL-HPA058102-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: gamma-aminobutyric acid type A receptor gamma1 subunit
Gene Name: GABRG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001260: 83%, ENSRNOG00000002360: 83%
Entrez Gene ID: 2565
Uniprot ID: Q8N1C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDC
Gene Sequence NKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDC
Gene ID - Mouse ENSMUSG00000001260
Gene ID - Rat ENSRNOG00000002360
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GABRG1 pAb (ATL-HPA058102)
Datasheet Anti GABRG1 pAb (ATL-HPA058102) Datasheet (External Link)
Vendor Page Anti GABRG1 pAb (ATL-HPA058102) at Atlas Antibodies

Documents & Links for Anti GABRG1 pAb (ATL-HPA058102)
Datasheet Anti GABRG1 pAb (ATL-HPA058102) Datasheet (External Link)
Vendor Page Anti GABRG1 pAb (ATL-HPA058102)