Anti GABRB1 pAb (ATL-HPA051297)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051297-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GABRB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029212: 97%, ENSRNOG00000002327: 100%
Entrez Gene ID: 2560
Uniprot ID: P18505
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNI |
Gene Sequence | IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNI |
Gene ID - Mouse | ENSMUSG00000029212 |
Gene ID - Rat | ENSRNOG00000002327 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GABRB1 pAb (ATL-HPA051297) | |
Datasheet | Anti GABRB1 pAb (ATL-HPA051297) Datasheet (External Link) |
Vendor Page | Anti GABRB1 pAb (ATL-HPA051297) at Atlas Antibodies |
Documents & Links for Anti GABRB1 pAb (ATL-HPA051297) | |
Datasheet | Anti GABRB1 pAb (ATL-HPA051297) Datasheet (External Link) |
Vendor Page | Anti GABRB1 pAb (ATL-HPA051297) |