Anti GABRB1 pAb (ATL-HPA051297)

Atlas Antibodies

Catalog No.:
ATL-HPA051297-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: gamma-aminobutyric acid (GABA) A receptor, beta 1
Gene Name: GABRB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029212: 97%, ENSRNOG00000002327: 100%
Entrez Gene ID: 2560
Uniprot ID: P18505
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNI
Gene Sequence IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNI
Gene ID - Mouse ENSMUSG00000029212
Gene ID - Rat ENSRNOG00000002327
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GABRB1 pAb (ATL-HPA051297)
Datasheet Anti GABRB1 pAb (ATL-HPA051297) Datasheet (External Link)
Vendor Page Anti GABRB1 pAb (ATL-HPA051297) at Atlas Antibodies

Documents & Links for Anti GABRB1 pAb (ATL-HPA051297)
Datasheet Anti GABRB1 pAb (ATL-HPA051297) Datasheet (External Link)
Vendor Page Anti GABRB1 pAb (ATL-HPA051297)