Anti GABPB2 pAb (ATL-HPA058483)

Atlas Antibodies

SKU: ATL-HPA058483-25

• 

Protein Description: GA binding protein transcription factor, beta subunit 2
Gene Name: GABPB2
Alternative Gene Name: MGC29891
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038766: 69%, ENSRNOG00000021105: 77%
Entrez Gene ID: 126626
Uniprot ID: Q8TAK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQYRLKLEAIARQQPNGVDFTMVEEVAEVDAVVVTEGELEERETKVTGSAGTTEPHTRVSMATVS
• Gene Sequence: EQYRLKLEAIARQQPNGVDFTMVEEVAEVDAVVVTEGELEERETKVTGSAGTTEPHTRVSMATVS
• Gene ID - Mouse: ENSMUSG00000038766
• Gene ID - Rat: ENSRNOG00000021105
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.