Anti GABPB2 pAb (ATL-HPA058483)

Atlas Antibodies

Catalog No.:
ATL-HPA058483-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: GA binding protein transcription factor, beta subunit 2
Gene Name: GABPB2
Alternative Gene Name: MGC29891
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038766: 69%, ENSRNOG00000021105: 77%
Entrez Gene ID: 126626
Uniprot ID: Q8TAK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EQYRLKLEAIARQQPNGVDFTMVEEVAEVDAVVVTEGELEERETKVTGSAGTTEPHTRVSMATVS
Gene Sequence EQYRLKLEAIARQQPNGVDFTMVEEVAEVDAVVVTEGELEERETKVTGSAGTTEPHTRVSMATVS
Gene ID - Mouse ENSMUSG00000038766
Gene ID - Rat ENSRNOG00000021105
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GABPB2 pAb (ATL-HPA058483)
Datasheet Anti GABPB2 pAb (ATL-HPA058483) Datasheet (External Link)
Vendor Page Anti GABPB2 pAb (ATL-HPA058483) at Atlas Antibodies

Documents & Links for Anti GABPB2 pAb (ATL-HPA058483)
Datasheet Anti GABPB2 pAb (ATL-HPA058483) Datasheet (External Link)
Vendor Page Anti GABPB2 pAb (ATL-HPA058483)