Anti GABPB2 pAb (ATL-HPA028471 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA028471-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GABPB2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408253).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GA binding protein transcription factor, beta subunit 2
Gene Name: GABPB2
Alternative Gene Name: MGC29891
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038766: 69%, ENSRNOG00000021105: 67%
Entrez Gene ID: 126626
Uniprot ID: Q8TAK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKSAFDIALEKNNAEILVILQEAMQNQVNVNPERANPVTDPVSMAAPFIFTSGEVVNLASLISSTNTKTTSGDPHASTVQFSNSTTS
Gene Sequence DKSAFDIALEKNNAEILVILQEAMQNQVNVNPERANPVTDPVSMAAPFIFTSGEVVNLASLISSTNTKTTSGDPHASTVQFSNSTTS
Gene ID - Mouse ENSMUSG00000038766
Gene ID - Rat ENSRNOG00000021105
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GABPB2 pAb (ATL-HPA028471 w/enhanced validation)
Datasheet Anti GABPB2 pAb (ATL-HPA028471 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GABPB2 pAb (ATL-HPA028471 w/enhanced validation)