Anti GABPB1 pAb (ATL-HPA067444)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067444-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GABPB1
Alternative Gene Name: E4TF1-47, GABPB, GABPB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027361: 94%, ENSRNOG00000021105: 52%
Entrez Gene ID: 2553
Uniprot ID: Q06547
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKK |
| Gene Sequence | ISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKK |
| Gene ID - Mouse | ENSMUSG00000027361 |
| Gene ID - Rat | ENSRNOG00000021105 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GABPB1 pAb (ATL-HPA067444) | |
| Datasheet | Anti GABPB1 pAb (ATL-HPA067444) Datasheet (External Link) |
| Vendor Page | Anti GABPB1 pAb (ATL-HPA067444) at Atlas Antibodies |
| Documents & Links for Anti GABPB1 pAb (ATL-HPA067444) | |
| Datasheet | Anti GABPB1 pAb (ATL-HPA067444) Datasheet (External Link) |
| Vendor Page | Anti GABPB1 pAb (ATL-HPA067444) |