Anti GABPB1 pAb (ATL-HPA067444)

Atlas Antibodies

Catalog No.:
ATL-HPA067444-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: GA binding protein transcription factor, beta subunit 1
Gene Name: GABPB1
Alternative Gene Name: E4TF1-47, GABPB, GABPB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027361: 94%, ENSRNOG00000021105: 52%
Entrez Gene ID: 2553
Uniprot ID: Q06547
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKK
Gene Sequence ISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKK
Gene ID - Mouse ENSMUSG00000027361
Gene ID - Rat ENSRNOG00000021105
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GABPB1 pAb (ATL-HPA067444)
Datasheet Anti GABPB1 pAb (ATL-HPA067444) Datasheet (External Link)
Vendor Page Anti GABPB1 pAb (ATL-HPA067444) at Atlas Antibodies

Documents & Links for Anti GABPB1 pAb (ATL-HPA067444)
Datasheet Anti GABPB1 pAb (ATL-HPA067444) Datasheet (External Link)
Vendor Page Anti GABPB1 pAb (ATL-HPA067444)