Anti GABARAPL1 pAb (ATL-HPA051386)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051386-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GABARAPL1
Alternative Gene Name: APG8L, ATG8B, ATG8L, gec1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055415: 27%, ENSRNOG00000017203: 26%
Entrez Gene ID: 23710
Uniprot ID: Q9H0R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TMGQLYEVMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPLTYGSVRL |
| Gene Sequence | TMGQLYEVMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPLTYGSVRL |
| Gene ID - Mouse | ENSMUSG00000055415 |
| Gene ID - Rat | ENSRNOG00000017203 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GABARAPL1 pAb (ATL-HPA051386) | |
| Datasheet | Anti GABARAPL1 pAb (ATL-HPA051386) Datasheet (External Link) |
| Vendor Page | Anti GABARAPL1 pAb (ATL-HPA051386) at Atlas Antibodies |
| Documents & Links for Anti GABARAPL1 pAb (ATL-HPA051386) | |
| Datasheet | Anti GABARAPL1 pAb (ATL-HPA051386) Datasheet (External Link) |
| Vendor Page | Anti GABARAPL1 pAb (ATL-HPA051386) |