Anti GABARAPL1 pAb (ATL-HPA051386)

Atlas Antibodies

Catalog No.:
ATL-HPA051386-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: GABA(A) receptor-associated protein like 1
Gene Name: GABARAPL1
Alternative Gene Name: APG8L, ATG8B, ATG8L, gec1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055415: 27%, ENSRNOG00000017203: 26%
Entrez Gene ID: 23710
Uniprot ID: Q9H0R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TMGQLYEVMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPLTYGSVRL
Gene Sequence TMGQLYEVMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPLTYGSVRL
Gene ID - Mouse ENSMUSG00000055415
Gene ID - Rat ENSRNOG00000017203
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GABARAPL1 pAb (ATL-HPA051386)
Datasheet Anti GABARAPL1 pAb (ATL-HPA051386) Datasheet (External Link)
Vendor Page Anti GABARAPL1 pAb (ATL-HPA051386) at Atlas Antibodies

Documents & Links for Anti GABARAPL1 pAb (ATL-HPA051386)
Datasheet Anti GABARAPL1 pAb (ATL-HPA051386) Datasheet (External Link)
Vendor Page Anti GABARAPL1 pAb (ATL-HPA051386)