Anti GABARAPL1 pAb (ATL-HPA051386)

Atlas Antibodies

Catalog No.: ATL-HPA051386-25

Protein Description: GABA(A) receptor-associated protein like 1
Gene Name: GABARAPL1
Alternative Gene Name: APG8L, ATG8B, ATG8L, gec1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055415: 27%, ENSRNOG00000017203: 26%
Entrez Gene ID: 23710
Uniprot ID: Q9H0R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TMGQLYEVMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPLTYGSVRL
• Gene Sequence: TMGQLYEVMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPLTYGSVRL
• Gene ID - Mouse: ENSMUSG00000055415
• Gene ID - Rat: ENSRNOG00000017203
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.