Anti GAB1 pAb (ATL-HPA066404)

Atlas Antibodies

Catalog No.:
ATL-HPA066404-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: GRB2 associated binding protein 1
Gene Name: GAB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031714: 90%, ENSRNOG00000017879: 88%
Entrez Gene ID: 2549
Uniprot ID: Q13480
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSKLDTIPDIPPPRPPKPHPAHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFP
Gene Sequence TSKLDTIPDIPPPRPPKPHPAHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFP
Gene ID - Mouse ENSMUSG00000031714
Gene ID - Rat ENSRNOG00000017879
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAB1 pAb (ATL-HPA066404)
Datasheet Anti GAB1 pAb (ATL-HPA066404) Datasheet (External Link)
Vendor Page Anti GAB1 pAb (ATL-HPA066404) at Atlas Antibodies

Documents & Links for Anti GAB1 pAb (ATL-HPA066404)
Datasheet Anti GAB1 pAb (ATL-HPA066404) Datasheet (External Link)
Vendor Page Anti GAB1 pAb (ATL-HPA066404)