Anti GAB1 pAb (ATL-HPA066404)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066404-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GAB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031714: 90%, ENSRNOG00000017879: 88%
Entrez Gene ID: 2549
Uniprot ID: Q13480
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TSKLDTIPDIPPPRPPKPHPAHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFP |
| Gene Sequence | TSKLDTIPDIPPPRPPKPHPAHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFP |
| Gene ID - Mouse | ENSMUSG00000031714 |
| Gene ID - Rat | ENSRNOG00000017879 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GAB1 pAb (ATL-HPA066404) | |
| Datasheet | Anti GAB1 pAb (ATL-HPA066404) Datasheet (External Link) |
| Vendor Page | Anti GAB1 pAb (ATL-HPA066404) at Atlas Antibodies |
| Documents & Links for Anti GAB1 pAb (ATL-HPA066404) | |
| Datasheet | Anti GAB1 pAb (ATL-HPA066404) Datasheet (External Link) |
| Vendor Page | Anti GAB1 pAb (ATL-HPA066404) |