Anti G6PC pAb (ATL-HPA052324)

Atlas Antibodies

Catalog No.:
ATL-HPA052324-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glucose-6-phosphatase, catalytic subunit
Gene Name: G6PC
Alternative Gene Name: G6PT, GSD1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078650: 94%, ENSRNOG00000051171: 88%
Entrez Gene ID: 2538
Uniprot ID: P35575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFIL
Gene Sequence MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFIL
Gene ID - Mouse ENSMUSG00000078650
Gene ID - Rat ENSRNOG00000051171
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti G6PC pAb (ATL-HPA052324)
Datasheet Anti G6PC pAb (ATL-HPA052324) Datasheet (External Link)
Vendor Page Anti G6PC pAb (ATL-HPA052324) at Atlas Antibodies

Documents & Links for Anti G6PC pAb (ATL-HPA052324)
Datasheet Anti G6PC pAb (ATL-HPA052324) Datasheet (External Link)
Vendor Page Anti G6PC pAb (ATL-HPA052324)
Citations for Anti G6PC pAb (ATL-HPA052324) – 3 Found
Cao, Jingsong; Choi, Minjung; Guadagnin, Eleonora; Soty, Maud; Silva, Marine; Verzieux, Vincent; Weisser, Edward; Markel, Arianna; Zhuo, Jenny; Liang, Shi; Yin, Ling; Frassetto, Andrea; Graham, Anne-Renee; Burke, Kristine; Ketova, Tatiana; Mihai, Cosmin; Zalinger, Zach; Levy, Becca; Besin, Gilles; Wolfrom, Meredith; Tran, Barbara; Tunkey, Christopher; Owen, Erik; Sarkis, Joe; Dousis, Athanasios; Presnyak, Vladimir; Pepin, Christopher; Zheng, Wei; Ci, Lei; Hard, Marjie; Miracco, Edward; Rice, Lisa; Nguyen, Vi; Zimmer, Mike; Rajarajacholan, Uma; Finn, Patrick F; Mithieux, Gilles; Rajas, Fabienne; Martini, Paolo G V; Giangrande, Paloma H. mRNA therapy restores euglycemia and prevents liver tumors in murine model of glycogen storage disease. Nature Communications. 2021;12(1):3090.  PubMed
Xu, Huiting; Wang, Yujue; Kwon, Hyokjoon; Shah, Ankit; Kalemba, Katarzyna; Su, Xiaoyang; He, Ling; Wondisford, Fredric E. Glucagon changes substrate preference in gluconeogenesis. The Journal Of Biological Chemistry. 2022;298(12):102708.  PubMed
Fang, Zhipeng; Fan, Mingjie; Yuan, Dongqiang; Jin, Lihua; Wang, Yangmeng; Ding, Lili; Xu, Senlin; Tu, Jui; Zhang, Eryun; Wu, Xiwei; Chen, Zhen Bouman; Huang, Wendong. Downregulation of hepatic lncRNA Gm19619 improves gluconeogenesis and lipogenesis following vertical sleeve gastrectomy in mice. Communications Biology. 2023;6(1):105.  PubMed