Anti FZR1 pAb (ATL-HPA043536)

Atlas Antibodies

SKU:
ATL-HPA043536-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & nuclear membrane.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: fizzy/cell division cycle 20 related 1 (Drosophila)
Gene Name: FZR1
Alternative Gene Name: CDC20C, CDH1, FZR, FZR2, HCDH, HCDH1, KIAA1242
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020235: 100%, ENSRNOG00000004169: 100%
Entrez Gene ID: 51343
Uniprot ID: Q9UM11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLA
Gene Sequence DHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLA
Gene ID - Mouse ENSMUSG00000020235
Gene ID - Rat ENSRNOG00000004169
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FZR1 pAb (ATL-HPA043536)
Datasheet Anti FZR1 pAb (ATL-HPA043536) Datasheet (External Link)
Vendor Page Anti FZR1 pAb (ATL-HPA043536) at Atlas Antibodies

Documents & Links for Anti FZR1 pAb (ATL-HPA043536)
Datasheet Anti FZR1 pAb (ATL-HPA043536) Datasheet (External Link)
Vendor Page Anti FZR1 pAb (ATL-HPA043536)