Anti FZD7 pAb (ATL-HPA069165)

Atlas Antibodies

Catalog No.:
ATL-HPA069165-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: frizzled class receptor 7
Gene Name: FZD7
Alternative Gene Name: FzE3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041075: 88%, ENSRNOG00000016119: 88%
Entrez Gene ID: 8324
Uniprot ID: O75084
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTAL
Gene Sequence CVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTAL
Gene ID - Mouse ENSMUSG00000041075
Gene ID - Rat ENSRNOG00000016119
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FZD7 pAb (ATL-HPA069165)
Datasheet Anti FZD7 pAb (ATL-HPA069165) Datasheet (External Link)
Vendor Page Anti FZD7 pAb (ATL-HPA069165) at Atlas Antibodies

Documents & Links for Anti FZD7 pAb (ATL-HPA069165)
Datasheet Anti FZD7 pAb (ATL-HPA069165) Datasheet (External Link)
Vendor Page Anti FZD7 pAb (ATL-HPA069165)