Anti FZD5 pAb (ATL-HPA052361)

Atlas Antibodies

Catalog No.:
ATL-HPA052361-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: frizzled class receptor 5
Gene Name: FZD5
Alternative Gene Name: C2orf31, DKFZP434E2135, HFZ5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045005: 91%, ENSRNOG00000014678: 91%
Entrez Gene ID: 7855
Uniprot ID: Q13467
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLP
Gene Sequence WPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLP
Gene ID - Mouse ENSMUSG00000045005
Gene ID - Rat ENSRNOG00000014678
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FZD5 pAb (ATL-HPA052361)
Datasheet Anti FZD5 pAb (ATL-HPA052361) Datasheet (External Link)
Vendor Page Anti FZD5 pAb (ATL-HPA052361) at Atlas Antibodies

Documents & Links for Anti FZD5 pAb (ATL-HPA052361)
Datasheet Anti FZD5 pAb (ATL-HPA052361) Datasheet (External Link)
Vendor Page Anti FZD5 pAb (ATL-HPA052361)