Anti FZD5 pAb (ATL-HPA052361)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052361-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FZD5
Alternative Gene Name: C2orf31, DKFZP434E2135, HFZ5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045005: 91%, ENSRNOG00000014678: 91%
Entrez Gene ID: 7855
Uniprot ID: Q13467
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLP |
| Gene Sequence | WPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLP |
| Gene ID - Mouse | ENSMUSG00000045005 |
| Gene ID - Rat | ENSRNOG00000014678 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FZD5 pAb (ATL-HPA052361) | |
| Datasheet | Anti FZD5 pAb (ATL-HPA052361) Datasheet (External Link) |
| Vendor Page | Anti FZD5 pAb (ATL-HPA052361) at Atlas Antibodies |
| Documents & Links for Anti FZD5 pAb (ATL-HPA052361) | |
| Datasheet | Anti FZD5 pAb (ATL-HPA052361) Datasheet (External Link) |
| Vendor Page | Anti FZD5 pAb (ATL-HPA052361) |