Anti FZD5 pAb (ATL-HPA052361)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052361-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FZD5
Alternative Gene Name: C2orf31, DKFZP434E2135, HFZ5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045005: 91%, ENSRNOG00000014678: 91%
Entrez Gene ID: 7855
Uniprot ID: Q13467
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLP |
Gene Sequence | WPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLP |
Gene ID - Mouse | ENSMUSG00000045005 |
Gene ID - Rat | ENSRNOG00000014678 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FZD5 pAb (ATL-HPA052361) | |
Datasheet | Anti FZD5 pAb (ATL-HPA052361) Datasheet (External Link) |
Vendor Page | Anti FZD5 pAb (ATL-HPA052361) at Atlas Antibodies |
Documents & Links for Anti FZD5 pAb (ATL-HPA052361) | |
Datasheet | Anti FZD5 pAb (ATL-HPA052361) Datasheet (External Link) |
Vendor Page | Anti FZD5 pAb (ATL-HPA052361) |