Anti FYTTD1 pAb (ATL-HPA074880)

Atlas Antibodies

Catalog No.: ATL-HPA074880-25

Protein Description: forty-two-three domain containing 1
Gene Name: FYTTD1
Alternative Gene Name: DKFZp761B1514, UIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022800: 88%, ENSRNOG00000034233: 90%
Entrez Gene ID: 84248
Uniprot ID: Q96QD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKANLLRQNEGQRKPVAVLKRPSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLLDDVVAKRTRQWR
• Gene Sequence: RKANLLRQNEGQRKPVAVLKRPSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLLDDVVAKRTRQWR
• Gene ID - Mouse: ENSMUSG00000022800
• Gene ID - Rat: ENSRNOG00000034233
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.