Anti FYTTD1 pAb (ATL-HPA074880)

Atlas Antibodies

SKU:
ATL-HPA074880-25
  • Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: forty-two-three domain containing 1
Gene Name: FYTTD1
Alternative Gene Name: DKFZp761B1514, UIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022800: 88%, ENSRNOG00000034233: 90%
Entrez Gene ID: 84248
Uniprot ID: Q96QD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKANLLRQNEGQRKPVAVLKRPSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLLDDVVAKRTRQWR
Gene Sequence RKANLLRQNEGQRKPVAVLKRPSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLLDDVVAKRTRQWR
Gene ID - Mouse ENSMUSG00000022800
Gene ID - Rat ENSRNOG00000034233
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FYTTD1 pAb (ATL-HPA074880)
Datasheet Anti FYTTD1 pAb (ATL-HPA074880) Datasheet (External Link)
Vendor Page Anti FYTTD1 pAb (ATL-HPA074880) at Atlas Antibodies

Documents & Links for Anti FYTTD1 pAb (ATL-HPA074880)
Datasheet Anti FYTTD1 pAb (ATL-HPA074880) Datasheet (External Link)
Vendor Page Anti FYTTD1 pAb (ATL-HPA074880)