Anti FYN pAb (ATL-HPA063770)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063770-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: FYN
Alternative Gene Name: MGC45350, SLK, SYN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019843: 100%, ENSRNOG00000000596: 100%
Entrez Gene ID: 2534
Uniprot ID: P06241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWE |
| Gene Sequence | QQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWE |
| Gene ID - Mouse | ENSMUSG00000019843 |
| Gene ID - Rat | ENSRNOG00000000596 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FYN pAb (ATL-HPA063770) | |
| Datasheet | Anti FYN pAb (ATL-HPA063770) Datasheet (External Link) |
| Vendor Page | Anti FYN pAb (ATL-HPA063770) at Atlas Antibodies |
| Documents & Links for Anti FYN pAb (ATL-HPA063770) | |
| Datasheet | Anti FYN pAb (ATL-HPA063770) Datasheet (External Link) |
| Vendor Page | Anti FYN pAb (ATL-HPA063770) |