Anti FYN pAb (ATL-HPA063770)

Atlas Antibodies

Catalog No.:
ATL-HPA063770-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: FYN proto-oncogene, Src family tyrosine kinase
Gene Name: FYN
Alternative Gene Name: MGC45350, SLK, SYN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019843: 100%, ENSRNOG00000000596: 100%
Entrez Gene ID: 2534
Uniprot ID: P06241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWE
Gene Sequence QQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWE
Gene ID - Mouse ENSMUSG00000019843
Gene ID - Rat ENSRNOG00000000596
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FYN pAb (ATL-HPA063770)
Datasheet Anti FYN pAb (ATL-HPA063770) Datasheet (External Link)
Vendor Page Anti FYN pAb (ATL-HPA063770) at Atlas Antibodies

Documents & Links for Anti FYN pAb (ATL-HPA063770)
Datasheet Anti FYN pAb (ATL-HPA063770) Datasheet (External Link)
Vendor Page Anti FYN pAb (ATL-HPA063770)