Anti FYCO1 pAb (ATL-HPA057966)

Atlas Antibodies

Catalog No.:
ATL-HPA057966-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FYVE and coiled-coil domain containing 1
Gene Name: FYCO1
Alternative Gene Name: FLJ13335, ZFYVE7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025241: 93%, ENSRNOG00000006336: 94%
Entrez Gene ID: 79443
Uniprot ID: Q9BQS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDPKSISFSVVFQEAEDTPLDQCKVLIPTTRCNSHKENIQGQLKVRTPGIYMLIFDNTFSRFVSKKVFYHLTVDRPVIYDGSD
Gene Sequence SDPKSISFSVVFQEAEDTPLDQCKVLIPTTRCNSHKENIQGQLKVRTPGIYMLIFDNTFSRFVSKKVFYHLTVDRPVIYDGSD
Gene ID - Mouse ENSMUSG00000025241
Gene ID - Rat ENSRNOG00000006336
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FYCO1 pAb (ATL-HPA057966)
Datasheet Anti FYCO1 pAb (ATL-HPA057966) Datasheet (External Link)
Vendor Page Anti FYCO1 pAb (ATL-HPA057966) at Atlas Antibodies

Documents & Links for Anti FYCO1 pAb (ATL-HPA057966)
Datasheet Anti FYCO1 pAb (ATL-HPA057966) Datasheet (External Link)
Vendor Page Anti FYCO1 pAb (ATL-HPA057966)