Anti FYB1 pAb (ATL-HPA067427 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA067427-25

• 

Protein Description: FYN binding protein 1
Gene Name: FYB1
Alternative Gene Name: ADAP, FYB, FYB-120/130, SLAP-130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022148: 78%, ENSRNOG00000013886: 76%
Entrez Gene ID: 2533
Uniprot ID: O15117
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKPAASRGGPGLSKNGEEKKEDRKIDAAKNTFQSKINQEELASGTPPARFPKAPSKLTVGGPWGQSQEKEKGDKNSATPKQKPLPPLFTLGP
• Gene Sequence: LKPAASRGGPGLSKNGEEKKEDRKIDAAKNTFQSKINQEELASGTPPARFPKAPSKLTVGGPWGQSQEKEKGDKNSATPKQKPLPPLFTLGP
• Gene ID - Mouse: ENSMUSG00000022148
• Gene ID - Rat: ENSRNOG00000013886
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.