Anti FXN pAb (ATL-HPA068304)

Atlas Antibodies

Catalog No.:
ATL-HPA068304-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: frataxin
Gene Name: FXN
Alternative Gene Name: CyaY, FA, FARR, FRDA, X25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059363: 59%, ENSRNOG00000015213: 63%
Entrez Gene ID: 2395
Uniprot ID: Q16595
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDV
Gene Sequence RTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDV
Gene ID - Mouse ENSMUSG00000059363
Gene ID - Rat ENSRNOG00000015213
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FXN pAb (ATL-HPA068304)
Datasheet Anti FXN pAb (ATL-HPA068304) Datasheet (External Link)
Vendor Page Anti FXN pAb (ATL-HPA068304) at Atlas Antibodies

Documents & Links for Anti FXN pAb (ATL-HPA068304)
Datasheet Anti FXN pAb (ATL-HPA068304) Datasheet (External Link)
Vendor Page Anti FXN pAb (ATL-HPA068304)