Anti FXN pAb (ATL-HPA068304)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068304-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FXN
Alternative Gene Name: CyaY, FA, FARR, FRDA, X25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059363: 59%, ENSRNOG00000015213: 63%
Entrez Gene ID: 2395
Uniprot ID: Q16595
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDV |
| Gene Sequence | RTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDV |
| Gene ID - Mouse | ENSMUSG00000059363 |
| Gene ID - Rat | ENSRNOG00000015213 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FXN pAb (ATL-HPA068304) | |
| Datasheet | Anti FXN pAb (ATL-HPA068304) Datasheet (External Link) |
| Vendor Page | Anti FXN pAb (ATL-HPA068304) at Atlas Antibodies |
| Documents & Links for Anti FXN pAb (ATL-HPA068304) | |
| Datasheet | Anti FXN pAb (ATL-HPA068304) Datasheet (External Link) |
| Vendor Page | Anti FXN pAb (ATL-HPA068304) |