Anti FUT9 pAb (ATL-HPA070923)

Atlas Antibodies

Catalog No.:
ATL-HPA070923-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
Gene Name: FUT9
Alternative Gene Name: Fuc-TIX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055373: 99%, ENSRNOG00000008475: 99%
Entrez Gene ID: 10690
Uniprot ID: Q9Y231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWF
Gene Sequence ADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWF
Gene ID - Mouse ENSMUSG00000055373
Gene ID - Rat ENSRNOG00000008475
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FUT9 pAb (ATL-HPA070923)
Datasheet Anti FUT9 pAb (ATL-HPA070923) Datasheet (External Link)
Vendor Page Anti FUT9 pAb (ATL-HPA070923) at Atlas Antibodies

Documents & Links for Anti FUT9 pAb (ATL-HPA070923)
Datasheet Anti FUT9 pAb (ATL-HPA070923) Datasheet (External Link)
Vendor Page Anti FUT9 pAb (ATL-HPA070923)