Anti FUT3 pAb (ATL-HPA046966)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046966-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FUT3
Alternative Gene Name: CD174, LE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055373: 39%, ENSRNOG00000008475: 39%
Entrez Gene ID: 2525
Uniprot ID: P21217
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KDLARYLQELDKDHARYLSYFRWRETLRPRSFSWAL |
Gene Sequence | KDLARYLQELDKDHARYLSYFRWRETLRPRSFSWAL |
Gene ID - Mouse | ENSMUSG00000055373 |
Gene ID - Rat | ENSRNOG00000008475 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FUT3 pAb (ATL-HPA046966) | |
Datasheet | Anti FUT3 pAb (ATL-HPA046966) Datasheet (External Link) |
Vendor Page | Anti FUT3 pAb (ATL-HPA046966) at Atlas Antibodies |
Documents & Links for Anti FUT3 pAb (ATL-HPA046966) | |
Datasheet | Anti FUT3 pAb (ATL-HPA046966) Datasheet (External Link) |
Vendor Page | Anti FUT3 pAb (ATL-HPA046966) |