Anti FUT2 pAb (ATL-HPA014402)

Atlas Antibodies

Catalog No.: ATL-HPA014402-25

Protein Description: fucosyltransferase 2 (secretor status included)
Gene Name: FUT2
Alternative Gene Name: SE, Se2, SEC2, sej
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055978: 54%, ENSRNOG00000021011: 54%
Entrez Gene ID: 2524
Uniprot ID: Q10981
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTL
• Gene Sequence: QRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTL
• Gene ID - Mouse: ENSMUSG00000055978
• Gene ID - Rat: ENSRNOG00000021011
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.